KCNG4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Kcng4 antibody is: synthetic peptide directed towards the middle region of RAT Kcng4. Synthetic peptide located within the following region: SDESPEAGERPSGSSYLEKVGLVLRVLRALRILYVMRLARHSLGLQTLGL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	potassium voltage-gated channel modifier subfamily G member 4
Database Link	NP_758857 Entrez Gene 307900 Rat UniProt ID Q8TDN1
Background	The function of this protein remains unknown.
Synonyms	KV6.3; KV6.4
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Dog: 86%; Mouse: 86%; Guinea pig: 85%
Reference Data
Protein Families	Druggable Genome, Ion Channels: Potassium, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.