KCTD12 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Kctd12 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Kctd12. Synthetic peptide located within the following region: PDRPPERYTSRYYLKFNFLEQAFDKLSESGFHMVACSSTGTCAFASSTDQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	potassium channel tetramerization domain containing 12
Database Link	NP_612453 Entrez Gene 239217 Mouse UniProt ID Q96CX2
Background	Kctd12 is an auxiliary subunit of GABA-B receptors that determine the pharmacology and kinetics of the receptor response. It increases agonist potency and markedly alter the G-protein signaling of the receptors by accelerating onset and promoting desensitization.
Synonyms	C13orf2; PFET1; PFETIN
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 93%; Guinea pig: 91%
Reference Data
Protein Families	Ion Channels: Other

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.