KCTD17 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KCTD17 antibody: synthetic peptide directed towards the middle region of human KCTD17. Synthetic peptide located within the following region: YGSEDQAEFLCVVSKELHSTPNGLSSESSRKTKSTEEQLEEQQQQEEEVE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	potassium channel tetramerization domain containing 17
Database Link	NP_078957 Entrez Gene 79734 Human UniProt ID Q8N5Z5
Background	The function of this protein remains unknown.
Synonyms	FLJ12242; FLJ98761
Note	Immunogen Sequence Homology: Human: 100%; Pig: 92%; Guinea pig: 92%; Rat: 86%; Mouse: 86%; Dog: 79%; Bovine: 79%
Reference Data
Protein Families	Ion Channels: Other

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.