LPCAT1 Rabbit Polyclonal Antibody
CAT#: TA338682
Rabbit Polyclonal Anti-LPCAT1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-LPCAT1 antibody: synthetic peptide directed towards the middle region of human LPCAT1. Synthetic peptide located within the following region: LRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 59 kDa |
Gene Name | lysophosphatidylcholine acyltransferase 1 |
Database Link | |
Background | Lysophosphatidylcholine (LPC) acyltransferase (LPCAT; EC 2.3.1.23) catalyzes the conversion of LPC to phosphatidylcholine (PC) in the remodeling pathway of PC biosynthesis. |
Synonyms | AGPAT9; AGPAT10; AYTL2; lpcat; LPCAT-1; lysoPAFAT; PFAAP3 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Bovine: 93%; Zebrafish: 92%; Guinea pig: 79% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |