Clmp Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Clmp antibody is: synthetic peptide directed towards the N-terminal region of Rat Clmp. Synthetic peptide located within the following region: LWLVTYYVGTLGTHTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	CXADR-like membrane protein
Database Link	NP_775177 Entrez Gene 286939 Rat UniProt ID Q8K1G0
Background	Human homolog plays a role in cell-cell adhesion.
Synonyms	ACAM; ASAM; CSBM
Note	Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.