MANEL (MANEAL) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-MANEAL antibody is: synthetic peptide directed towards the middle region of Human MANEAL. Synthetic peptide located within the following region: YTYFASNGFSFGSSHQNWKAVKNFCDANNLMFIPSVGPGYIDTSIRPWNN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	mannosidase endo-alpha like
Database Link	NP_689709 Entrez Gene 149175 Human UniProt ID Q5VSG8
Background	The function of this protein remains unknown.
Synonyms	RP11-109P14.3
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Zebrafish: 93%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Rabbit: 79%; Guinea pig: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.