LENG4 (MBOAT7) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LENG4 antibody: synthetic peptide directed towards the C terminal of human LENG4. Synthetic peptide located within the following region: WWLAQYIYKSAPARSYVLRSAWTMLLSAYWHGLHPGYYLSFLTIPLCLAA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	53 kDa
Gene Name	membrane bound O-acyltransferase domain containing 7
Database Link	NP_077274 Entrez Gene 79143 Human UniProt ID Q96N66
Background	MBOAT7 belongs to the membrane-bound acyltransferase family. It is involved in arachidonate recycling, thus regulating free arachidonic acid levels and leukotriene synthesis in neutrophils.
Synonyms	BB1; hMBOA-7; LENG4; LPIAT; LRC4; MBOA7; OACT7
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.