TMEM38A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMEM38A antibody: synthetic peptide directed towards the N terminal of human TMEM38A. Synthetic peptide located within the following region: GEPLIDYFSNNSSILLASAVWYLIFFCPLDLFYKCVCFLPVKLIFVAMKE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	transmembrane protein 38A
Database Link	NP_076979 Entrez Gene 79041 Human UniProt ID Q9H6F2
Background	TMEM38A is a monovalent cation channel required for maintenance of rapid intracellular calcium release. It may act as a potassium counter-ion channel that functions in synchronization with calcium release from intracellular stores.
Synonyms	TRIC-A; TRICA
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Bovine: 93%; Yeast: 90%; Rat: 86%; Horse: 86%; Mouse: 86%; Guinea pig: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.