ACCN2 (ASIC1) Rabbit Polyclonal Antibody
CAT#: TA338589
Rabbit Polyclonal Anti-ACCN2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 2,900.00
CNY 6,650.00
CNY 4,840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ACCN2 antibody: synthetic peptide directed towards the N terminal of human ACCN2. Synthetic peptide located within the following region: MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 65 kDa |
Gene Name | acid sensing ion channel subunit 1 |
Database Link | |
Background | The protein encoded by this gene contains an N-terminal forkhead domain, two BRCA1 C-terminal (BRCT) motifs and a central domain with 13 repetitions of an approximately 41-amino acid sequence. The encoded protein is required to activate the intra-S phase and G2/M phase cell cycle checkpoints in response to DNA damage. This nuclear protein interacts with phosphorylated histone H2AX near sites of DNA double-strand breaks through its BRCT motifs, and facilitates recruitment of the ATM kinase and meiotic recombination 11 protein complex to DNA damage foci. [provided by RefSeq, Jul 2008] |
Synonyms | ACCN2; ASIC; BNaC2 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Other |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |