Mucolipin 3 (MCOLN3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MCOLN3 antibody: synthetic peptide directed towards the middle region of human MCOLN3. Synthetic peptide located within the following region: TVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	64 kDa
Gene Name	mucolipin 3
Database Link	NP_060768 Entrez Gene 55283 Human UniProt ID Q8TDD5
Background	This gene encodes one of members of the mucolipin cation channel proteins. Mutation studies of the highly similar protein in mice have shown that the protein is found in cochlea hair cells, and mutant mice show early-onset hearing loss and balance problems. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]
Synonyms	TRP-ML3; TRPML3
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Zebrafish: 91%
Reference Data
Protein Families	Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.