TPCN1 Rabbit Polyclonal Antibody

CAT#: TA338582

Rabbit Polyclonal Anti-TPCN1 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Transient overexpression lysate of two pore segment channel 1 (TPCN1), transcript variant 1
    • 100 ug

CN¥ 4,840.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-TPCN1 antibody: synthetic peptide directed towards the N terminal of human TPCN1. Synthetic peptide located within the following region: YQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 94 kDa
Gene Name two pore segment channel 1
Background Voltage-gated Ca(2+) and Na+ channels have 4 homologous domains, each containing 6 transmembrane segments, S1 to S6. TPCN1 is similar to these channels, but it has only 2 domains containing S1 to S6 (Ishibashi et al., 2000 [PubMed 10753632]). [supplied by OMIM, Mar 2008]. Transcript Variant: This variant (2) differs in the 5' UTR, lacks a portion of the 5' coding region, and uses a downstream start codon, compared to variant 1. The encoded isoform (2) has a shorter N-terminus compared to isoform 1. ##Evidence-Data-START## Transcript exon combination :: BC150203.1, AB032995.2 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
Synonyms TPC1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Mouse: 93%
Reference Data
Protein Families Druggable Genome, Ion Channels: Other, Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...