TRPC4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TRPC4 antibody: synthetic peptide directed towards the middle region of human TRPC4. Synthetic peptide located within the following region: CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	112 kDa
Gene Name	transient receptor potential cation channel subfamily C member 4
Database Link	NP_057263 Entrez Gene 7223 Human UniProt ID Q9UBN4
Background	This gene encodes a member of the canonical subfamily of transient receptor potential cation channels. The encoded protein forms a non-selective calcium-permeable cation channel that is activated by Gq-coupled receptors and tyrosine kinases, and plays a role in multiple processes including endothelial permeability, vasodilation, neurotransmitter release and cell proliferation. Single nucleotide polymorphisms in this gene may be associated with generalized epilepsy with photosensitivity. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2011]
Synonyms	HTRP-4; HTRP4; TRP4
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Rat: 92%; Bovine: 86%; Pig: 85%; Guinea pig: 82%; Horse: 77%
Reference Data
Protein Families	Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.