PKDREJ Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PKDREJ antibody: synthetic peptide directed towards the middle region of human PKDREJ. Synthetic peptide located within the following region: GVADNGSVLEITPDVAEVYLVRKNLTFAAFNLTVGPNSEVDGSLKKTTGG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	254 kDa
Gene Name	polycystin (PKD) family receptor for egg jelly
Database Link	NP_006062 Entrez Gene 10343 Human UniProt ID Q9NTG1
Background	This intronless gene encodes a member of the polycystin protein family. The encoded protein contains 11 transmembrane domains, a receptor for egg jelly (REJ) domain, a G-protein-coupled receptor proteolytic site (GPS) domain, and a polycystin-1, lipoxygenase, alpha-toxin (PLAT) domain. This protein may play a role in human reproduction. Alternative splice variants have been described but their biological natures have not been determined. [provided by RefSeq, Jul 2008]
Synonyms	OTTHUMP00000028714; polycystic kidney disease (polycystin) and REJ (sperm receptor for egg jelly; polycystic kidney disease (polycystin) and REJ (sperm receptor for egg jelly homolog; receptor for egg jelly-like; sea urchin)-like; sea urchin homolog)-like
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.