KCNK5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Kcnk5 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AWLSLFVNWKVSMFVEVHKAIKKRRRRRKESFESSPHSRKALQMAGSTAS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	potassium two pore domain channel subfamily K member 5
Database Link	NP_003731 Entrez Gene 16529 Mouse UniProt ID O95279
Background	The function of this protein remains unknown.
Synonyms	K2p5.1; KCNK5b; TASK-2; TASK2
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Horse: 93%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome, Ion Channels: Potassium, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.