CLIC1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the C terminal of human CLIC1. Synthetic peptide located within the following region: LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	chloride intracellular channel 1
Database Link	NP_001279 Entrez Gene 1192 Human UniProt ID O00299
Background	Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity. [provided by RefSeq, Jul 2008]
Synonyms	G6; NCC27
Note	Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Dog: 92%; Pig: 92%; Guinea pig: 92%; Goat: 83%; Bovine: 83%
Reference Data
Protein Families	Druggable Genome, Ion Channels: Other

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.