Neuroligin 4 (NLGN4X) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NLGN4X antibody: synthetic peptide directed towards the middle region of human NLGN4X. Synthetic peptide located within the following region: ELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	92 kDa
Gene Name	neuroligin 4, X-linked
Database Link	NP_065793 Entrez Gene 57502 Human UniProt ID Q8N0W4
Background	NLGN4X is a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. It interacts with discs, large (Drosophila) homolog 4 (DLG4). NLGN4X might play a role in the autism and Asperger syndrome.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests. This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. The encoded protein interacts with discs, large (Drosophila) homolog 4 (DLG4). Mutations in this gene have been associated with autism and Asperger syndrome. Two transcript variants encoding the same protein have been identified for this gene.
Synonyms	ASPGX2; AUTSX2; HLNX; HNL4X; NLGN4
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	Cell adhesion molecules (CAMs)

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.