APMAP Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-APMAP antibody: synthetic peptide directed towards the N terminal of human APMAP. Synthetic peptide located within the following region: EPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	adipocyte plasma membrane associated protein
Database Link	NP_065392 Entrez Gene 57136 Human UniProt ID Q9HDC9
Background	The exact function of APMAP remains unknown.
Synonyms	BSCv; C20orf3
Note	Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 92%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.