TMEM63C Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMEM63C antibody: synthetic peptide directed towards the middle region of human TMEM63C. Synthetic peptide located within the following region: EEEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPASSPARHTYGTM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	93 kDa
Gene Name	transmembrane protein 63C
Database Link	NP_065164 Entrez Gene 57156 Human UniProt ID Q9P1W3
Background	The specific function of the protein remains unknown.
Synonyms	C14orf171; CSC1; hsCSC1
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 92%; Dog: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.