DMGDH Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Dmgdh antibody is: synthetic peptide directed towards the middle region of Mouse Dmgdh. Synthetic peptide located within the following region: SELHDLRWIEEAAFRGGYDVEIQNITDEFGVLGVAGPYARRVLQKLTSE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	93 kDa
Gene Name	dimethylglycine dehydrogenase
Database Link	NP_037523 Entrez Gene 74129 Mouse UniProt ID Q9UI17
Background	The function of this protein remains unknown.
Synonyms	DMGDHD; ME2GLYDH
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Bovine: 93%; Guinea pig: 92%; Zebrafish: 83%
Reference Data
Protein Pathways	Glycine, serine and threonine metabolism, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.