CLCN1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Clcn1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: SSIFQRLLHCLLGKAHSTKKKITQDSTDLVDNMSPEEIEAWEREQLSQPV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	110 kDa
Gene Name	chloride voltage-gated channel 1
Database Link	NP_000074 Entrez Gene 12723 MouseEntrez Gene 25688 Rat UniProt ID P35523
Background	plays a role in chloride ion transport and membrane conductance in skeletal muscle [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: X62894.1, AY112740.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SRS369733, SRS369742 [ECO:0000348] ##Evidence-Data-END##
Synonyms	CLC1
Note	Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Goat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Guinea pig: 86%
Reference Data
Protein Families	Druggable Genome, Ion Channels: Other, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.