Oprm1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Oprm1 antibody is: synthetic peptide directed towards the middle region of Mouse Oprm1. Synthetic peptide located within the following region: CYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	opioid receptor, mu 1
Database Link	NP_001034741 Entrez Gene 18390 Mouse UniProt ID P42866
Background	This gene encodes the mu opioid receptor which is where drugs such as morphine and other opioids have pharmacological effects. Alternatively spliced transcript variants have been found for this gene, however, many of these variants may be NMD candidates.
Synonyms	hMOP; KIAA0403; LMOR; MOP; MOR; MOR-1; MOR1; OPRM
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Goat: 93%; Sheep: 93%; Rabbit: 93%; Zebrafish: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.