ENGASE Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ENGASE antibody is: synthetic peptide directed towards the N-terminal region of Human ENGASE. Synthetic peptide located within the following region: RRRQLQGLAAPEAGTQEEQEDQEPRPRRRRPGRSIKDEEEETVFREVVSF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	endo-beta-N-acetylglucosaminidase
Database Link	NP_001036038 Entrez Gene 64772 Human UniProt ID Q8NFI3
Background	This gene encodes a cytosolic enzyme which catalyzes the hydrolysis of peptides and proteins with mannose modifications to produce free oligosaccharides.
Synonyms	DKFZp434P174; FLJ21865
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Pathways	Other glycan degradation

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.