Orexin Receptor 1 (HCRTR1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HCRTR1 antibody is: synthetic peptide directed towards the N-terminal region of Human HCRTR1. Synthetic peptide located within the following region: ATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	hypocretin receptor 1
Database Link	NP_001516 Entrez Gene 3061 Human UniProt ID O43613
Background	The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein selectively binds the hypothalamic neuropeptide orexin A. A related gene (HCRTR2) encodes a G-protein coupled receptor that binds orexin A and orexin B.
Synonyms	OX1R
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 91%; Bovine: 85%; Pig: 83%; Guinea pig: 83%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome, ES Cell Differentiation/IPS, GPCR, Transmembrane
Protein Pathways	Neuroactive ligand-receptor interaction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.