BMP8B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-BMP8B antibody is: synthetic peptide directed towards the N-terminal region of Human BMP8B. Synthetic peptide located within the following region: CPQRRLGARERRDVQREILAVLGLPGRPRPRAPPAASRLPASAPLFMLDL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	bone morphogenetic protein 8b
Database Link	NP_001711 Entrez Gene 656 Human UniProt ID P34820
Background	The function of this protein remains unknown.
Synonyms	BMP8; OP2
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Bovine: 86%; Horse: 80%; Zebrafish: 80%
Reference Data
Protein Families	Adult stem cells, Cancer stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Secreted Protein, Stem cell relevant signaling - TGFb/BMP signaling pathway
Protein Pathways	Hedgehog signaling pathway, TGF-beta signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.