PTCH2 Rabbit Polyclonal Antibody

CAT#: TA338213

Rabbit Polyclonal Anti-PTCH2 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (2)
Transient overexpression lysate of patched homolog 2 (Drosophila) (PTCH2), transcript variant 1
    • 100 ug

CN¥ 4,840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PTCH2 antibody: synthetic peptide directed towards the N terminal of human PTCH2. Synthetic peptide located within the following region: LAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 130 kDa
Gene Name patched 2
Background This gene encodes a transmembrane receptor of the patched gene family. The encoded protein may function as a tumor suppressor in the hedgehog signaling pathway. Alterations in this gene have been associated with nevoid basal cell carcinoma syndrome, basal cell carcinoma, medulloblastoma, and susceptibility to congenital macrostomia. Alternatively spliced transcript variants have been described. [provided by RefSeq, Oct 2009]
Synonyms PTC2
Note Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%; Rabbit: 86%; Pig: 79%; Guinea pig: 79%
Reference Data
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Basal cell carcinoma, Hedgehog signaling pathway, Pathways in cancer
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...