SGPL1 Rabbit Polyclonal Antibody

CAT#: TA338200

Rabbit Polyclonal Anti-SGPL1 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of sphingosine-1-phosphate lyase 1 (SGPL1)
    • 100 ug

CN¥ 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Recombinant protein of human sphingosine-1-phosphate lyase 1 (SGPL1), 20 µg
    • 20 ug

CN¥ 2,900.00
CN¥ 6,650.00


Recombinant protein of human sphingosine-1-phosphate lyase 1 (SGPL1), 100 µg
    • 100 ug

CN¥ 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SGPL1 antibody is: synthetic peptide directed towards the C-terminal region of Human SGPL1. Synthetic peptide located within the following region: IHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 63 kDa
Gene Name sphingosine-1-phosphate lyase 1
Background SGPL1 cleaves phosphorylated sphingoid bases (PSBs), such as sphingosine-1-phosphate, into fatty aldehydes and phosphoethanolamine. SGPL1 elevates stress-induced ceramide production and apoptosis.
Synonyms S1PL; SPL
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Goat: 93%; Zebrafish: 91%; Guinea pig: 86%
Reference Data
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Sphingolipid metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...