S1PR2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-S1PR2 antibody is: synthetic peptide directed towards the N-terminal region of Human S1PR2. Synthetic peptide located within the following region: MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	sphingosine-1-phosphate receptor 2
Database Link	NP_004221 Entrez Gene 9294 Human UniProt ID O95136
Background	This gene encodes a member of the G protein-coupled receptors, as well as the EDG family of proteins. This protein participates in sphingosine 1-phosphate-induced cell proliferation, survival, and transcriptional activation.
Synonyms	AGR16; EDG-5; EDG5; Gpcr13; H218; LPB2; S1P2
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Dog: 86%; Pig: 86%; Mouse: 86%; Guinea pig: 86%; Horse: 79%
Reference Data
Protein Families	Druggable Genome, GPCR, Transmembrane
Protein Pathways	Neuroactive ligand-receptor interaction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.