ANGPTL1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ANGPTL1 antibody is: synthetic peptide directed towards the C-terminal region of Human ANGPTL1. Synthetic peptide located within the following region: PDLATSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVNGIFWAEYRGGS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	30 kDa
Gene Name	angiopoietin like 1
Database Link	NP_004664 Entrez Gene 9068 Human UniProt ID O95841
Background	The function of this protein remains unknown.
Synonyms	ANG3; ANGPT3; AngY; ARP1; dJ595C2.2; UNQ162
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Guinea pig: 86%; Bovine: 79%; Zebrafish: 79%
Reference Data
Protein Families	Druggable Genome, Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.