FGFR1OP2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FGFR1OP2 antibody is: synthetic peptide directed towards the C-terminal region of Human FGFR1OP2. Synthetic peptide located within the following region: ANQNELQAHVDQITEMAAVMRKAIEIDEQQGCKEQERIFQLEQENKGLRE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	FGFR1 oncogene partner 2
Database Link	NP_056448 Entrez Gene 26127 Human UniProt ID Q9NVK5
Background	FGFR1OP2 may be involved in wound healing pathway.
Synonyms	HSPC123-like; WIT3.0
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.