BEN Domain Containing Protein 5 (BEND5) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-BEND5 antibody is: synthetic peptide directed towards the N-terminal region of Human BEND5. Synthetic peptide located within the following region: EDKSDLENSVMQKKIKIPKLSLNHVEEDGEVKDYGEEDLQLRHIKRPEGR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	BEN domain containing 5
Database Link	NP_078879 Entrez Gene 79656 Human UniProt ID Q7L4P6
Background	The function of this protein remains unknown.
Synonyms	C1orf165
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Dog: 93%; Mouse: 93%; Pig: 86%; Rat: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.