L2HGDH Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-L2HGDH antibody is: synthetic peptide directed towards the middle region of Human L2HGDH. Synthetic peptide located within the following region: GSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	L-2-hydroxyglutarate dehydrogenase
Database Link	NP_079160 Entrez Gene 79944 Human UniProt ID Q9H9P8
Background	This gene encodes L-2-hydroxyglutarate dehydrogenase, a FAD-dependent enzyme that oxidizes L-2-hydroxyglutarate to alpha-ketoglutarate in a variety of mammalian tissues. Mutations in this gene cause L-2-hydroxyglutaric aciduria, a rare autosomal recessive neurometabolic disorder resulting in moderate to severe mental retardation.
Synonyms	C14orf160; L2HGA
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 91%; Dog: 86%; Horse: 86%; Rabbit: 86%; Guinea pig: 86%; Mouse: 79%
Reference Data
Protein Pathways	Butanoate metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.