LZTR2 (SEC16B) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SEC16B antibody is: synthetic peptide directed towards the C-terminal region of Human SEC16B. Synthetic peptide located within the following region: KSSGFGWFSWFRSKPTKNASPAGDEDSSDSPDSEETPRASSPHQAGLGLS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	59 kDa
Gene Name	SEC16 homolog B, endoplasmic reticulum export factor
Database Link	NP_149118 Entrez Gene 89866 Human UniProt ID Q96JE7
Background	SEC16B is a mammalian homolog of S. cerevisiae Sec16 that is required for organization of transitional endoplasmic reticulum (ER) sites and protein export.
Synonyms	LZTR2; PGPR-p117; RGPR; SEC16S
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.