EGLN2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-EGLN2 antibody: synthetic peptide directed towards the N terminal of human EGLN2. Synthetic peptide located within the following region: MCLPSPSKPTSLHPCQAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	16 kDa
Gene Name	egl-9 family hypoxia inducible factor 2
Database Link	NP_444274 Entrez Gene 112398 Human UniProt ID Q96KS0
Background	The hypoxia inducible factor (HIF) is a transcriptional complex which is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. EGLN2 encodes an enzyme responsible for this posttranslational modification. Alternative splicing of EGLN2 results in three transcript variants encoding different isoforms.
Synonyms	EIT6; HIF-PH1; HIFPH1; HPH-1; HPH-3; PHD1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Sheep: 86%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Pathways in cancer, Renal cell carcinoma

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.