RNF36 (TRIM69) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RNF36 antibody: synthetic peptide directed towards the N terminal of human RNF36. Synthetic peptide located within the following region: SIQAKTEQQNSFDFLKDITTLLHSLEQGMKVLATRELISRKLNLGQYKGP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	tripartite motif containing 69
Database Link	NP_542783 Entrez Gene 140691 Human UniProt ID Q86WT6
Background	RNF36 is specifically expressed in germ cells at round spermatid stages during spermatogenesis. The protein encoded by this gene contains an N-terminal RING finger motif, a B-box, and a C-terminal B-30.2-like domain. When overexpressed in COS-7 and HEK-293 cells, this protein was shown to induce cell apoptosis.
Synonyms	HSD-34; HSD34; RNF36; Trif
Note	Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 85%; Mouse: 85%; Horse: 79%; Bovine: 79%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.