ROR alpha (RORA) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Rora antibody is synthetic peptide directed towards the middle region of Mouse Rora. Synthetic peptide located within the following region: STYMDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	59 kDa
Gene Name	RAR related orphan receptor A
Database Link	NP_599024 Entrez Gene 19883 Mouse UniProt ID P35398
Background	Rora is an orphan nuclear receptor. It binds DNA as a monomer to hormone response elements (HRE) containing a single core motif half-site preceded by a short A-T-rich sequence. This isomer binds to the consensus sequence 5'-[AT][TA]A[AT][CGT]TAGGTCA-3'. Regulates a number of genes involved in lipid metabolism such as apolipoproteins AI, APOA5, CIII, CYP71 and PPARgamma, in cerebellum and photoreceptor development including PCP2, OPN1SW, OPN1SM AND ARR3, in circadian rhythm with BMAL1, and skeletal muscle development with MYOD1. IT is a possible receptor for cholesterol or one of its derivatives.
Synonyms	NR1F1; ROR1; ROR2; ROR3; RZR-ALPHA; RZRA
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Goat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Guinea pig: 93%
Reference Data
Protein Families	Druggable Genome, Nuclear Hormone Receptor, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.