ASPRV1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ASPRV1antibody: synthetic peptide directed towards the middle region of human SASP. Synthetic peptide located within the following region: RGEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFANSM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	aspartic peptidase, retroviral-like 1
Database Link	NP_690005 Entrez Gene 151516 Human UniProt ID Q53RT3
Background	The specific function of ASPRV1is not yet known.
Synonyms	MUNO; SASP; SASPase; Taps
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rat: 93%; Pig: 92%; Guinea pig: 92%
Reference Data
Protein Families	Druggable Genome, Protease

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.