NKAIN4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NKAIN4 antibody: synthetic peptide directed towards the N terminal of human NKAIN4. Synthetic peptide located within the following region: MGSCSGRCALVVLCAFQLVAALERQVFDFLGYQWAPILANFVHIIIVILG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	23 kDa
Gene Name	Na+/K+ transporting ATPase interacting 4
Database Link	NP_690603 Entrez Gene 128414 Human UniProt ID Q8IVV8
Background	The specific function of NKAIN4 is not yet known.
Synonyms	bA261N11.2; C20orf58; FAM77A
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Mouse: 93%; Pig: 92%; Bovine: 92%; Horse: 90%; Zebrafish: 86%; Guinea pig: 86%; Rat: 83%; Rabbit: 83%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.