CD95 (FAS) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FAIM2 antibody is: synthetic peptide directed towards the N-terminal region of Human FAIM2. Synthetic peptide located within the following region: QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	Fas cell surface death receptor
Database Link	NP_690615 Entrez Gene 355 Human UniProt ID P25445
Background	The function of this protein remains unknown.
Synonyms	ALPS1A; APO-1; APT1; CD95; FAS1; FASTM; TNFRSF6
Note	Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 79%; Horse: 79%; Mouse: 79%; Bovine: 79%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein
Protein Pathways	Allograft rejection, Alzheimer's disease, Apoptosis, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Graft-versus-host disease, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, p53 signaling pathway, Pathways in cancer, Type I diabetes mellitus

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.