NIRF (UHRF2) Rabbit Polyclonal Antibody
CAT#: TA337863
Rabbit Polyclonal Anti-UHRF2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
Cited in 1 publication. |
CNY 4,840.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-UHRF2 antibody: synthetic peptide directed towards the N terminal of human UHRF2. Synthetic peptide located within the following region: TNKLDSVPSTSNSDCVAADEDVIYHIQYDEYPESGTLEMNVKDLRPRART |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 90 kDa |
Gene Name | ubiquitin like with PHD and ring finger domains 2 |
Database Link | |
Background | UHRF2 encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. |
Synonyms | NIRF; RNF107; TDRD23; URF2 |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Mouse: 86%; Bovine: 86% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
UHRF genes regulate programmed interdigital tissue regression and chondrogenesis in the embryonic limb
,Sanchez-Fernandez, C;Lorda-Diez, CI;García-Porrero, JA;Montero, JA;Hurlé, JM;,
Cell Death Dis
,PubMed ID 31024001
[UHRF2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |