IL4I1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-IL4I1 antibody is: synthetic peptide directed towards the C-terminal region of Human IL4I1. Synthetic peptide located within the following region: PHGWVETAVKSALRAAIKINSRKGPASDTASPEGHASDMEGQGHVHGVAS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	61 kDa
Gene Name	interleukin 4 induced 1
Database Link	NP_690863 Entrez Gene 259307 Human UniProt ID Q96RQ9
Background	The protein encoded by this gene shares the limited similarity with L-amino acid oxidase, and contains the conserved key amino acid residues thought to be involved in catalysis and binding of the flavin adenine dinucleotide cofactor. The expression of this gene can be induced by interleukin 4 in B cells. Two alternatively spliced transcript variants of this gene encoding two distinct isoforms have been reported.
Synonyms	FIG1; LAAO; LAO
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Alanine, aspartate and glutamate metabolism, Cysteine and methionine metabolism, Metabolic pathways, Phenylalanine, tyrosine and tryptophan biosynthesis, Phenylalanine metabolism, Tryptophan metabolism, Tyrosine metabolism, Valine, leucine and isoleucine degradation

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.