TREML1 Rabbit Polyclonal Antibody

CAT#: TA337742

Rabbit Polyclonal Anti-TREML1 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of triggering receptor expressed on myeloid cells-like 1 (TREML1)
    • 100 ug

CN¥ 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Recombinant protein of human triggering receptor expressed on myeloid cells-like 1 (TREML1), 20 µg
    • 20 ug

CN¥ 2,900.00
CN¥ 6,650.00


Recombinant protein of human triggering receptor expressed on myeloid cells-like 1 (TREML1), 100 µg
    • 100 ug

CN¥ 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-TREML1 antibody is: synthetic peptide directed towards the middle region of Human TREML1. Synthetic peptide located within the following region: GSLAENAFSDPAGSANPLEPSQDEKSIPLIWGAVLLVGLLVAAVVLFAVM
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 22 kDa
Gene Name triggering receptor expressed on myeloid cells like 1
Background TREML1 is located in a gene cluster on chromosome 6 with the single Ig variable (IgV) domain activating receptors TREM1 and TREM2, but it has distinct structural and functional properties. TREML1 enhances calcium signaling in an SHP2-dependent manner.
Synonyms dJ238O23.3; GLTL1825; PRO3438; TLT-1; TLT1
Note Immunogen Sequence Homology: Human: 100%; Dog: 86%
Reference Data
Protein Families Druggable Genome, Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...