TREML1 Rabbit Polyclonal Antibody
CAT#: TA337742
Rabbit Polyclonal Anti-TREML1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TREML1 antibody is: synthetic peptide directed towards the middle region of Human TREML1. Synthetic peptide located within the following region: GSLAENAFSDPAGSANPLEPSQDEKSIPLIWGAVLLVGLLVAAVVLFAVM |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 22 kDa |
Gene Name | triggering receptor expressed on myeloid cells like 1 |
Database Link | |
Background | TREML1 is located in a gene cluster on chromosome 6 with the single Ig variable (IgV) domain activating receptors TREM1 and TREM2, but it has distinct structural and functional properties. TREML1 enhances calcium signaling in an SHP2-dependent manner. |
Synonyms | dJ238O23.3; GLTL1825; PRO3438; TLT-1; TLT1 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 86% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |