Prss35 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Prss35 antibody is: synthetic peptide directed towards the middle region of Mouse Prss35. Synthetic peptide located within the following region: HDGKDYVKGSKKLRVGVLKMRNKGGRKKRRGSKRSRREAESAGQSQAHLR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	protease, serine 35
Database Link	NP_848853 Entrez Gene 244954 Mouse UniProt ID Q8C0F9
Background	The function of this protein remains unknown.
Synonyms	C6orf158; dJ223E3.1; MGC46520
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 93%; Horse: 86%; Bovine: 79%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.