PRKAR1B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse, Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PRKAR1B antibody: synthetic peptide directed towards the middle region of human PRKAR1B. Synthetic peptide located within the following region: LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	protein kinase cAMP-dependent type I regulatory subunit beta
Database Link	NP_002726 Entrez Gene 19085 MouseEntrez Gene 5575 Human UniProt ID P31321
Background	Cyclic AMP-dependent protein kinase A (PKA) is an essential enzyme in the signaling pathway of the second messenger cAMP. Through phosphorylation of target proteins, PKA controls many biochemical events in the cell including regulation of metabolism, ion transport, and gene transcription. The PKA holoenzyme is composed of 2 regulatory and 2 catalytic subunits and dissociates from the regulatory subunits upon binding of cAMP. [supplied by OMIM, Jun 2009]. Transcript Variant: This variant (4) differs in the 5' UTR compared to variant 1. All 6 variants encode the same protein. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## CDS exon combination :: AL833563.1, BC026734.1 [ECO:0000331] RNAseq introns :: mixed/partial sample support ERS025087, ERS025093 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
Synonyms	PRKAR1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Horse: 92%; Sheep: 85%; Rabbit: 85%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Apoptosis, Insulin signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.