PMM1 Rabbit Polyclonal Antibody

CAT#: TA337686

Rabbit Polyclonal Anti-PMM1 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of phosphomannomutase 1 (PMM1)
    • 100 ug

CN¥ 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Recombinant protein of human phosphomannomutase 1 (PMM1), 20 µg
    • 20 ug

CN¥ 2,900.00
CN¥ 6,650.00


Recombinant protein of human phosphomannomutase 1 (PMM1), 100 µg
    • 100 ug

CN¥ 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PMM1 antibody: synthetic peptide directed towards the N terminal of human PMM1. Synthetic peptide located within the following region: MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 30 kDa
Gene Name phosphomannomutase 1
Background Phosphomannomutase catalyzes the conversion between D-mannose 6-phosphate and D-mannose 1-phosphate which is a substrate for GDP-mannose synthesis. GDP-mannose is used for synthesis of dolichol-phosphate-mannose, which is essential for N-linked glycosylat
Synonyms Sec53
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Yeast: 86%; Zebrafish: 79%
Reference Data
Protein Pathways Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Metabolic pathways
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...