DHRS9 Rabbit Polyclonal Antibody

CAT#: TA337615

Rabbit Polyclonal Anti-DHRS9 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2, 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-DHRS9 antibody: synthetic peptide directed towards the middle region of human DHRS9. Synthetic peptide located within the following region: DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 35 kDa
Gene Name dehydrogenase/reductase 9
Background This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. This protein demonstrates oxidoreductase activity toward hydroxysteroids and is able to convert 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone in the cytoplasm, and may additionally function as a transcriptional repressor in the nucleus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
Synonyms 3-alpha-HSD; 3ALPHA-HSD; RDH-E2; RDH-TBE; RDH15; RDHL; RDHTBE; RETSDR8; SDR9C4
Note Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 92%
Reference Data
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Retinol metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...