FAM36A (COX20) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-COX20 antibody: synthetic peptide directed towards the C terminal of human COX20. Synthetic peptide located within the following region: LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	13 kDa
Gene Name	COX20 cytochrome c oxidase assembly factor
Database Link	NP_932342 Entrez Gene 116228 Human UniProt ID Q5RI15
Background	COX20 is a multi-pass membrane protein. It belongs to the FAM36 family. The exact function of COX20 remains unknown.
Synonyms	FAM36A
Note	Immunogen Sequence Homology: Human: 100%; Rat: 90%; Mouse: 90%; Horse: 79%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.