AASDH Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-AASDH antibody: synthetic peptide directed towards the middle region of human AASDH. Synthetic peptide located within the following region: TDGKVWILESQSGQLQSVYELPGEVFSSPVVLESMLIIGCRDNYVYCLDL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	122 kDa
Gene Name	aminoadipate-semialdehyde dehydrogenase
Database Link	NP_861522 Entrez Gene 132949 Human UniProt ID Q4L235
Background	Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA.
Synonyms	ACSF4; LYS2; NRPS998; NRPS1098
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%
Reference Data
Protein Pathways	Lysine biosynthesis, Lysine degradation, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.