NHEDC2 (SLC9B2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SLC9B2 antibody: synthetic peptide directed towards the C terminal of human SLC9B2. Synthetic peptide located within the following region: IFISFAWLPKATVQAAIGSVALDTARSHGEKQLEDYGMDVLTVAFLSILI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	solute carrier family 9 member B2
Database Link	NP_849155 Entrez Gene 133308 Human UniProt ID Q86UD5
Background	Sodium hydrogen antiporters, such as SLC9B2, convert the proton motive force established by the respiratory chain or the F1F0 mitochondrial ATPase into sodium gradients that drive other energy-requiring processes, transduce environmental signals into cell responses, or function in drug efflux.Sodium hydrogen antiporters, such as SLC9B2, convert the proton motive force established by the respiratory chain or the F1F0 mitochondrial ATPase into sodium gradients that drive other energy-requiring processes, transduce environmental signals into cell responses, or function in drug efflux (Xiang et al., 2007 [PubMed 18000046]). [supplied by OMIM]
Synonyms	NHA2; NHE10; NHEDC2
Note	Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Guinea pig: 83%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.