LRRC50 (DNAAF1) Rabbit Polyclonal Antibody

CAT#: TA337574

Rabbit Polyclonal Anti-DNAAF1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of leucine rich repeat containing 50 (LRRC50)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human leucine rich repeat containing 50 (LRRC50), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human leucine rich repeat containing 50 (LRRC50), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-DNAAF1antibody: synthetic peptide directed towards the N terminal of human LRRC50. Synthetic peptide located within the following region: LNDTLYLHFKGFDRIENLEEYTGLRCLWLQSNGIQKIENLEAQTELRCLF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 80 kDa
Gene Name dynein (axonemal) assembly factor 1
Background DNAAF1contains 6 LRR (leucine-rich) repeats. It is proposed that DNAAF1to be a novel candidate gene for human cystic kidney disease, involved in regulation of microtubule-based cilia and actin-based brush border microvilli.
Synonyms CILD13; LRRC50; ODA7; swt
Note Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 79%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...