LRRC46 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-LRRC46 antibody is: synthetic peptide directed towards the C-terminal region of Human LRRC46. Synthetic peptide located within the following region: SPTKKPCSLIPRGHQSSFWGRKGARAATAPKASVAEAPSTTKTTAKRSKK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	leucine rich repeat containing 46
Database Link	NP_219481 Entrez Gene 90506 Human UniProt ID Q96FV0
Background	The function of this protein remains unknown.
Synonyms	FLJ23553; MGC16309
Note	Immunogen Sequence Homology: Human: 100%; Rat: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.